#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4wmd_C_1_H_1

Protein Model on 4wmd_C_1_H_1 (TEMPLATE: 4wmd )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [303 aa] ORF1a :W6A941_9BETC
2 b H 1 (C) non-polymer(1PE) PENTAETHYLENE GLYCOL 6M 7A(S) 8F(H) 113S 298R(M) 302G (identity: 50.0 %/51.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4wmd_C_1 identity=51.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4wmd_C_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TTTTTS  HHHHHHT  GGGEEEE  SSS  EE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbbbbbeeeebeebebeebeeebeeeebebebeeeeeeebebebeeeeebbbebebeeebee:    
Contact         :     bbb                                                                                            

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *  *   **:
4wmd_C_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEE     TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :               b                                                                                    

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4wmd_C_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS      HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeebebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    

queryA       297:VRQCSGV: 303
                :  *  **:
4wmd_C_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebeeee:    
Contact         : b   b                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123