#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4ylu_A_1_F_1

Protein Model on 4ylu_A_1_F_1 (TEMPLATE: 4ylu )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] ORF1a protein :A0A0A7E693_9BETC
2 b F 1 (A) non-polymer(ACT) ACETATE ION 103F 104V(T) 105R(T) 176D(A) 178E(D) (identity: 20.0 %/52.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ylu_A_1 identity=52.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4ylu_A_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGTTS  HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeeeebbbbbbeeebbbbebbbbeeeeeeebebeebeeebeeeebebebbeeeeeebebebeeeeebbbebebeeebee:    

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
4ylu_A_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  EEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbbebebeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :     bbb                                                                      b b                   

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4ylu_A_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHT-T  TT  BTTBSS   S  HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbebbeeeebbebeeeebbee---bbeebebbbbbbbebbbebe-eebeeeebeebeebebbbbbebb:    

queryA       297:VRQCSGV: 303
                :  *  **:
4ylu_A_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123