#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4yo9_B_1_G_1

Protein Model on 4yo9_B_1_G_1 (TEMPLATE: 4yo9 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_BCHK4
2 b G 1 (A) non-polymer(SIN) SUCCINIC ACID 11G 14E 15G(N) 70A(G) (identity: 50.0 %/51.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4yo9_B_1 identity=51.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yo9_B_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGS  SS  SS  HHHHHHHS GGG EEEB SSS B   EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeebeeeebeeebeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :          b  bb                                                         b                           

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yo9_B_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     GGGTT EEEEEETTEEEEEEEEEEE SSS EEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbeebeeeeeebbbbbebbbbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeee:    

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yo9_B_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHH-HHS  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebbbebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    

queryA       297:VRQ: 299
                :  *:
4yo9_B_1     297:NMQ: 299
SecStr          :HHH:    
ExpBur          :beb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123