#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4yoi_B_1_A_1

Protein Model on 4yoi_B_1_A_1 (TEMPLATE: 4yoi )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4
2 b A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4 1S 2G 4R(V) 5K 6M 7A(S) 9P 10S 11G 14E 122P 123S(T) 124G 125V 126Y(F) 137K 138G 139S 140F 141L 166E 169T(N) 170G 172H 214N 283G 285A(S) 286L(T) 299Q 301S(M) (identity: 73.3 %/51.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4yoi_B_1 identity=51.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yoi_B_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGTTS  HHHHHHH  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbebeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebeeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :bb bbbb bbb  b                                                                                      

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yoi_B_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :   EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEESSS EEEEEEEEEEEETTEEEEE TTS BSSS  SSSS       :    
ExpBur          :eeeeeeeebeebebbbbbbbeebebeeeebbbbbebbbbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                        bbbbb          bbbbb                        b  bb b                         

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yoi_B_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHH   HHHHHHHHHH-HHH  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbbeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebebebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         :                b                                                                     b bb          

queryA       297:VRQCSGVTFQ: 306
                :  *  **  *:
4yoi_B_1     297:NMQVMGVVMQ: 306
SecStr          :HHH  S    :    
ExpBur          :eeebeeeeee:    
Contact         :  b b                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123