#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4zro_B_1_J_1

Protein Model on 4zro_B_1_J_1 (TEMPLATE: 4zro )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_FIPV
2 b J 1 (B) non-polymer(DMS) DIMETHYL SULFOXIDE 180N(E) (identity: 0.0 %/44.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4zro_B_1 identity=44.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***  *     ***     *  * *         * ***   ** ** :
4zro_B_1       1:SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebeeeeeeeebebbbeeeebebeeeeeeebbbbbebeeebeeebe:    

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **    **  *  **** * *  **   **   ******  * *****         * **** **  * * *  ***  **   *    *  **    :
4zro_B_1     100:HKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEE SSSEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbeeebbbeeebeebbbbbbbbbeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeebb:    
Contact         :                                                                               b                    

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***      **   *  *             *    * * **  *          *  *  *****    * *****  * ** :
4zro_B_1     200:SDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB     --SGGGHHHHHHHT  HHHHHHHHHH-HTT  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeeeeebbeeeebebeebbebbeeeebeebee--eeebeebbeeeeeebeebbebbbe-beeebeeeebbeeeebbbebbbebbbeee:    

queryA       301:SGV: 303
                : **:
4zro_B_1     297:YGV: 299
SecStr          :TT :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123