#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4zro_D_1_A_1

Protein Model on 4zro_D_1_A_1 (TEMPLATE: 4zro )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_FIPV
2 b A 1 (A) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_FIPV 191A(M) 193A(L) 196T 221N(T) 223F(T) 224T(S) 225T(M) 233V(W) 236K(T) 237Y(N) 238N(S) 266A(E) 270E(R) 273Q(N) 274N(K) 275G (identity: 12.5 %/44.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4zro_D_1 identity=44.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***  *     ***     *  * *         * ***   ** ** :
4zro_D_1       1:SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGGEEEE TT    EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebeeebeeeebebeeeeeebebeeeebeebbbbbebeeebeeebe:    

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **    **  *  **** * *  **   **   ******  * *****         * **** **  * * *  ***  **   *    *  **    :
4zro_D_1     100:HKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbeeebbbeeebeeebbbbbbbbeeeeebbbbbbbbbebeebbbbbbbbebebbeebebbeeebebeeeeeb:    
Contact         :                                                                                          b b  b    

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***      **   *  *             *    * * **  *          *  *  *****    * *****  * ** :
4zro_D_1     200:SDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB     --GGGGHHHHHHH   HHHHHHHHHH-HTT  TT  BTTBSS   S  HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeeeeebbeeeebebeebbebbeeeebeebee--eeebeebbeebeeebeebbebbbe-beeebeeeebbeeeebbbebbbebbbeeb:    
Contact         :                    b bbb       b  bbb                           b   b  bbb                         

queryA       301:SGV: 303
                : **:
4zro_D_1     297:YGV: 299
SecStr          :H  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123