#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5eu8_A_2_C_2

Protein Model on 5eu8_A_2_C_2 (TEMPLATE: 5eu8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 2 (A) polymer(polypeptide(L)) [300 aa] main protease :V9PIT1_9ALPC
2 b C 2 (A) non-polymer(ZN) ZINC ION 41H 164H 187D (identity: 100.0 %/44.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5eu8_A_2 identity=44.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :** **** *** ** * * *  *   ****** * * ******         ***  *     ***     *  * *         * ***   ** ** :
5eu8_A_2       6:SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPE: 104
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGS S SSS -  HHHHHHT  GGGEEEEETTEEE EEE  EETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeeebbbbbbbeeebbbbbbbbbeeeeee-bebeebeeeeeeeebebebeeeebebeeeebeebbbbbebeeebeeebe:    
Contact         :                                        b                                                           

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                : **    **  *  **** * *  **   **   ******  * *****         * **** **  * * *  ***  **   *    *  **    :
5eu8_A_2     105:HKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMS: 204
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE SSS BGGG  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbeebbbeeebeebbebbbbbbeeeeebbbbbbbbeebeeebbbbbbbebebbeebebbeeeeebeeeeeb:    
Contact         :                                                               b                      b             

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :  ** * **** *** ***      **   *  *             *    * * **  *          *  *  *****    * *****  * ** :
5eu8_A_2     205:SDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 301
SecStr          :HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHTTTB     --SGGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeebeebebeeebebeebbebbeeeebeebee--eeebeebbeebeeebeebbbbbbe-beeebeeeebbeeeebbbbbbbebbeeeb:    

queryA       301:SGV: 303
                : **:
5eu8_A_2     302:YGV: 304
SecStr          :T  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123