#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5gwz_B_1_D_1

Protein Model on 5gwz_B_1_D_1 (TEMPLATE: 5gwz )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (A) polymer(polypeptide(L)) [299 aa] PEDV main protease :R1A_PEDV7
2 b D 1 (E) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 25T(M) 26T(A) 27L 41H 47E(T) 140F 142N 143G 145C 163H 164H(Q) 165M(L) 166E 167L 168P(G) 172H 188R(Q) 189Q(P) 190T 191A(L) 192Q (identity: 57.1 %/46.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5gwz_B_1 identity=46.1%
queryA         2:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :* **** *** ** * * *  *   ****** * * ******  *        *     *   ***    *** * *    *    *  **   *  ***:
5gwz_B_1       7:GLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPK: 104
SecStr          :         HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S SSS   HHHHHHH  G--GGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :ebebeeeebeebeebbbebbbeeeebbbbbbbeebbbbbbbbbeeeeeebebeebeeebee--eebebbeeeeebebeebeeeebbbebebeeebeeebe:    
Contact         :                       bbb             b     b                                                      

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :*      **  *  **** *   ***   ** * ** *** ** *** * **    * *** *  **  * * * ** *  **   *  * *  *     :
5gwz_B_1     105:YTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLF: 204
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbebebbebebeeebbbbbbbeeeeebbbbbbbbbeebeeebbbbbbbebebbeebebbeeeeeeeeeeeb:    
Contact         :                                       b bb b                 bbbbbb   b               bbbbb        

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **** **** ***  * *         **  *        *    *    * * **  *    **   *  *   *  ***   * ****   **** :
5gwz_B_1     205:TENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT--TVGNTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQM: 301
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB --     GGGHHHHHHHT  HHHHHHHHHHHTT - SS  BTTBSS      HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeebeebeeeeebebeebbeebeeeebb--ebeeeeebeebeeeeebebeebbbbbeebbee-beeeebeeeeebbbebbbebbbeee:    

queryA       301:SGV: 303
                : **:
5gwz_B_1     302:YGV: 304
SecStr          :H  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123