#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5hyo_A_1_G_1

Protein Model on 5hyo_A_1_G_1 (TEMPLATE: 5hyo )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [301 aa] PEDV 3CLpro :A0A075EBR7_9ALPC
2 b G 1 (A) non-polymer(IPA) ISOPROPYL ALCOHOL 35V(T) 37Y(I) 88K(Q) 101Y 103F(Y) (identity: 20.0 %/45.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5hyo_A_1 identity=45.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  *   ****** * * ******  *        *     *   ***    *** * * *  *    *  **   *  **:
5hyo_A_1       1:AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGSS SSSS   HHHHHHT  G--GGEEEEETTEEE EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebebeeeebeebeebbbebbbeebebbbbbbbebbbbbbbbbbeeeeeebebeebeeebee--eebebbeeeeebebeeeeeeebbbebebeeebeeeb:    
Contact         :                                  b b                                                   b           

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :**      **  *  **** **  ***   ** * ** *** ** *** * **    * *** *  **  * * * ** *  **   *  * *  *    :
5hyo_A_1      99:KYTYRTVRPGESFNILACYDGSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSL: 198
SecStr          : EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbebeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeeeeeeeeee:    
Contact         : b b                                                                                                

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : * **** **** ***  * *         **  *             *    * * **  *    **   *  *   *  ***   * ****   * **:
5hyo_A_1     199:FTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB    --  GGGHHHHHHH   HHHHHHHHHHHHS -  SS BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebbbeeebebeebbebbeeeebbebe--eeeebeebeeeeebebeebbbbbbebeee-eeeeebbeeebbbbbbbbebbbee:    

queryA       300:CSGVTF: 305
                :  **  :
5hyo_A_1     296:MYGVNL: 301
SecStr          :HHS   :    
ExpBur          :beeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123