#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5hyo_B_1_A_1

Protein Model on 5hyo_B_1_A_1 (TEMPLATE: 5hyo )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [301 aa] PEDV 3CLpro :A0A075EBR7_9ALPC
2 b A 1 (A) polymer(polypeptide(L)) [301 aa] PEDV 3CLpro :A0A075EBR7_9ALPC 1S(A) 2G 3F(L) 4R 5K 6M 7A 8F(Q) 9P 10S 11G 14E 122P(A) 123S(A) 124G 125V 126Y 127Q(G) 128C(V) 137K(R) 138G 139S 140F 141L(I) 166E 170G 172H 272L(H) 274N 278G 279R(K) 282L 283G 284S(Y) 285A(T) 290E 299Q 300C(M) (identity: 63.2 %/45.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5hyo_B_1 identity=45.7%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  *   ****** * * ******  *        *     *   ***    *** * * *  *    *  **   *  **:
5hyo_B_1       1:AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS SS SS  HHHHHHT  G--GGEEEEETTEE  EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeeebebeebeeebee--eebebbeeeeebeeeeeeeeebbbebebeeebeeee:    
Contact         :bbbbbbbbbbb  b                                                                                      

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :**      **  *  **** **  ***   ** * ** *** ** *** * **    * *** *  **  * * * ** *  **   *  * *  *    :
5hyo_B_1      99:KYTYRTVRPGESFNILACYDGSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSL: 198
SecStr          : EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbbebeeeeeebbbbbebebbeeebeeebbbbbbbebeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeee:    
Contact         :                      bbbbbbb        bbbbb                        b   b b                           

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : * **** **** ***  * *         **  *             *    * * **  *    **   *  *   *  ***   * ****   * **:
5hyo_B_1     199:FTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB    -- TTTTHHHHHHHT  HHHHHHHHHHHHT - S   SSSSSSS     HHHHHHH:    
ExpBur          :ebbbbbbbbbbbbeeebeebebeeebeeeebbeebeeeebbebe--eeeebeebeeeeebebeebbbbbeebeee-eeeeebeeeeebbbbbbbbbbbee:    
Contact         :                                                                        b b   bb  bbbb    b        b

queryA       300:CSGVTF: 305
                :  **  :
5hyo_B_1     296:MYGVNL: 301
SecStr          :HH    :    
ExpBur          :beeeee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123