#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5nh0_B_1_A_2

Protein Model on 5nh0_B_1_A_2 (TEMPLATE: 5nh0 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [300 aa] Replicase polyprotein 1ab :R1AB_CVHNL
2 b A 2 (A) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL 169T(S) 193A(V) 195G(S) 196T(A) 197D(N) 198T(L) 235M 236K(A) 237Y(N) 238N(G) (identity: 10.0 %/45.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5nh0_B_1 identity=45.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  *** *** ** * * *  * * *** ** * * ******  *   *   *         *** *    * * * *  *   **  **   *  ***:
5nh0_B_1       1:SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYSTMRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPK:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S SSS -  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebebeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeee-bebeebeeebeeeebebbbeeeebeeeebeeeebbbebebeeebeeebe:    

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :  *    **  *  **** *  ***     * ******** ** *** * *   *  * *** *  **  * * * *  *  ** * *    *       :
5nh0_B_1     100:HVFKTLKPGDSFNILACYEGIASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLM: 199
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEE TTS EEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeebeeeeebbbbbbeebeeeeeebbbbeebebbeeebeeebbbbbbbbeeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeee:    
Contact         :                                                                     b                       b bbbb 

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                :   ** * ****  ** ** *         **  **   *       *     * * **  *    **    *  *  *  ***   * ****   ** *:
5nh0_B_1     200:LSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGYTSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ: 296
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB     --GGGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebbbeeebebeebbebbeeeebbebee--eeebeebeeebebebebbbbbbee-beeebeeeebeeeeebbbebbeebbeee:    
Contact         :                                   bbbb                                                             

queryA       300:CSGV: 303
                :  **:
5nh0_B_1     297:MYGV: 300
SecStr          :HH  :    
ExpBur          :beee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123