#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5nh0_C_2_B_2

Protein Model on 5nh0_C_2_B_2 (TEMPLATE: 5nh0 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 2 (C) polymer(polypeptide(L)) [299 aa] Replicase polyprotein 1ab :R1AB_CVHNL
2 b B 2 (B) polymer(polypeptide(L)) [300 aa] Replicase polyprotein 1ab :R1AB_CVHNL 1S 2G 4R(K) 5K 6M 7A 9P 10S 11G 14E 15G(R) 122P(A) 123S 124G 125V 126Y(F) 127Q(G) 128C(V) 137K 138G 139S 140F 141L(I) 166E 170G 172H 285A(S) 286L(S) 290E 299Q 300C(M) 301S(Y) 302G (identity: 66.7 %/45.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5nh0_C_2 identity=45.0%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :**  *** *** ** * * *  * * *** ** * * ******  *   *   *         *** *    * * * *  *   **  **   *  ***:
5nh0_C_2       1:SGLKKMAQPSGCVERCVVRVCYGSTVLNGVWLGDTVTCPRHVIAPSTTVL-IDYDHAYSTMRLHNFSVSHNGVFLGVVGVTMHGSVLRIKVSQSNVHTPK:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG S SSS -  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeee-bebeebeeebeeeebebbbeeeebeeeebeeeebbbebebeeebeeebe:    
Contact         :bb bbbb bbb  bb                                                                                     

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD-CVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :  *    **  *  **** *  ***     * ******** ** *** * *   *  * *** *  **  * * * *  *  ** * *    *       :
5nh0_C_2     100:HVFKTLKPGDSFNILACYEGIASGVFGVNLRTNFTIKGSFINGACGSPGYNVRNDGTVEFCYLHQIELGSGAHVGSDFTGSVYGNFDDQPSLQVESANLM: 199
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEE TTS EEEEEEEEEE TTS EEEE TTS BGGG  SSS         B:    
ExpBur          :eeeeebeeeeebbbbbbeebeeeeeebbbbeebebbeeebeeebbbbbbbbeeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeee:    
Contact         :                     bbbbbbb        bbbbb                         b   b b                           

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                :   ** * ****  ** ** *         **  **   *       *     * * **  *    **    *  *  *  ***   * ****   ** *:
5nh0_C_2     200:LSDNVVAFLYAALLNGCRWWLCSTRVNVDGFNEWAMANGYTSVSS--VECYSILAAKTGVSVEQLLASIQH-LHEGFGGKNILGYSSLCDEFTLAEVVKQ: 296
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB     --GGGGHHHHHHHT  HHHHHHHHHH-HTT  TT  BTTBSS   S  HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebebeeebeeeebbebbeeeebbebee--eeebeebeeebebebebbbbbbee-beeebeeeebeeeeebbbebbeebbeee:    
Contact         :                                                                                     bb   b        b

queryA       300:CSG: 302
                :  *:
5nh0_C_2     297:MYG: 299
SecStr          :HH :    
ExpBur          :bee:    
Contact         :bbb                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123