#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5wkk_A_2_B_2

Protein Model on 5wkk_A_2_B_2 (TEMPLATE: 5wkk )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 2 (A) polymer(polypeptide(L)) [301 aa] Orf1a protein :A0A1L2E0X0_9BETC
2 b B 2 (A) non-polymer(PG4) TETRAETHYLENE GLYCOL 6M 7A(S) 8F(H) 298R(M) (identity: 25.0 %/52.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5wkk_A_2 identity=52.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
5wkk_A_2       8:SGLVKMSHPSGDVEACMVQVTCGXMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHXXXXANLRVVGHAMQGTLLKLTVDVANPS: 107
SecStr          : S        HHHHTTEEEEEE - EEEEEEETTEEEEEGGGGS GGGTTS  HHHHHHH  GGGEEEE  ---- EE EEEEEEETTEEEEEESS  TT:    
ExpBur          :bebeeeeeebeebeebbbbbbbe-eebbbbbbeeebbbbbbbbbeeebeeebebeebbeebeeeebebebe----eebebeeeeeeebbbbbebeeebee:    
Contact         :     bbb                                                                                            

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
5wkk_A_2     108:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 207
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbeebbeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeeee:    

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
5wkk_A_2     208:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 303
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-T  TT  BTTBSS   SS HHHH:    
ExpBur          :bebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebebebbbebbbebe-eebeeeebeeeeebebebbbebb:    

queryA       297:VRQCSGV: 303
                :  *  **:
5wkk_A_2     304:NMQIMGV: 310
SecStr          :HHHTT  :    
ExpBur          :beeeeee:    
Contact         : b                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123