#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5zqg_A_1_C_1

Protein Model on 5zqg_A_1_C_1 (TEMPLATE: 5zqg )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [292 aa] Non-structural protein :R4JK63_9ALPC
2 b C 1 (C) polymer(polypeptide(L)) [7 aa] PEPTIDE LEU-ALA-GLN-LEU-GLN-VAL-ALA 24T(N) 25T(M) 26T(A) 27L 41H 140F 141L(I) 143G 144S(A) 145C(A) 163H 164H(Q) 165M(L) 166E 172H 187D 188R(Q) 189Q(P) 190T 191A(L) 192Q (identity: 47.6 %/44.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5zqg_A_1 identity=44.8%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDM-LNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:  99
                : * **** *** ** * * *  *   ****** * * ******           *     *   ***    *** * * *  *    *  **   *  **:
5zqg_A_1       2:AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVMCPRHVIAXXXXXXIDYDYALSVLRL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTP:  99
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG ------  HHHHHHT  G--GGEEEEETTEEE EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebebeeeebeebeebbbebbbeeeebbbbbbeebbbbbbebbe------eebeebeeebee--eebebbeeeeebeeeebebeebbbebebeeebeeeb:    
Contact         :                       bbbb             b                                                           

queryA       100:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT: 199
                :**      **  *  **** *   ***   ** * ** *** **  ** * **    * *** *  **  * * * ** *  **   *  * *  *    :
5zqg_A_1     100:KYTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGAAGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSL: 199
SecStr          :SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbeebeeeeeebbbbeebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeee:    
Contact         :                                        bb bbb                 bbbb     b              bbbbbb       

queryA       200:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ: 299
                : * **** **** ***  * *         **  *             *    * * **  *    **   *  *   *  ***   * ****   * **:
5zqg_A_1     200:FTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ: 296
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB    --  GGGHHHHHHHS  HHHHHHHHHHHHH - TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebebeeebebeebbeebeeeebeebe--eeeebeebeeeeebebeebbbbbeebeee-beeeebeeeeebbbbbbbebbeee:    

queryA       300:CSG: 302
                :  *:
5zqg_A_1     297:MYG: 299
SecStr          :HH :    
ExpBur          :bee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123