#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6vh1_A_1_C_1

Protein Model on 6vh1_A_1_C_1 (TEMPLATE: 6vh1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [298 aa] Orf1a protein :A0A1L2E0X0_9BETC
2 b C 1 (A) non-polymer(QZ7) N~2~-{[(4,4-difluorocyclohexyl)oxy]carbonyl}-N-{(2S)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propan-2-yl}-L-leucinamide 41H 49M(L) 140F 141L 142N(C) 143G 144S 145C 163H 164H(Q) 165M 166E 167L 172H 187D 189Q (identity: 81.2 %/52.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6vh1_A_1 identity=52.2%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:  97
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
6vh1_A_1       8:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIXXXXXLRVVGHAMQGTLLKLTVDVANPS: 107
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS GGG SS  HHHHHHT  GGGEEEE   -----  EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbbbeebebbbbbbeeebbbbbbbbbeeeebeebebeebbeebeeeebebeeee-----ebbebeeeeebbbebebeeebee:    
Contact         :                                        b       b                                                   

queryA        98:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD: 197
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
6vh1_A_1     108:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 207
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B S   TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS       :    
ExpBur          :bbeeeeeebeebeebbbbbbbebbeeeeeebbbbbbebbeeebeeebbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebebeee:    
Contact         :                                          bbbbbb                 bbbbb    b              b b        

queryA       198:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV: 296
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
6vh1_A_1     208:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 303
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS   S  HHHH:    
ExpBur          :eebbbbbbbbbbbbbeeeeeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeebebebebbbebbeebe-eebeebebeeeeebbbebbbeeb:    

queryA       297:VRQ: 299
                :  *:
6vh1_A_1     304:NMQ: 306
SecStr          :HHH:    
ExpBur          :eeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123