#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6w79_A_2_D_2

Protein Model on 6w79_A_2_D_2 (TEMPLATE: 6w79 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 2 (A) polymer(polypeptide(L)) [306 aa] Main protease
2 b D 2 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID 105R 134F(H) 181F 182Y 183G (identity: 80.0 %/96.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w79_A_2 identity=96.1%
queryA         1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100
                :********************************** ********** ****************** ******************** * ***** ******:
6w79_A_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TT SSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeeeeeeebebebeeeebebebeeebebbbebebeeebeeebe:    

queryA       101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200
                :********************************* ********************************************* ********************:
6w79_A_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS          B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebeeb:    
Contact         :    b                            b                                              bbb                 

queryA       201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300
                :* **************************************************************** *****************  **************:
6w79_A_2     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbbbeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbebbeeebeeeebeebeebebebbbebbeeeb:    

queryA       301:SGVTFQ: 306
                :******:
6w79_A_2     301:SGVTFQ: 306
SecStr          : SS   :    
ExpBur          :eeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123