#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xbh_A_1_B_1

Protein Model on 6xbh_A_1_B_1 (TEMPLATE: 6xbh )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [304 aa] main protease :R1AB_SARS2
2 b B 1 (C) polymer(polypeptide(L)) [3 aa] inhibitor UAW247 41H 49M 54Y 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 172H 187D 188R 189Q (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xbh_A_1 identity=100.0%
queryA         2:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY: 101
                :****************************************************************************************************:
6xbh_A_1       4:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY: 103
SecStr          :         HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGG SS  HHHHHHH  GGG EEEETTEE  EEEEEEETTEEEEEESS  TT  SE:    
ExpBur          :ebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeeebeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebee:    
Contact         :                                       b       b    b                                               

queryA       102:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT: 201
                :****************************************************************************************************:
6xbh_A_1     104:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT: 203
SecStr          :EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B H:    
ExpBur          :eeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeebb:    
Contact         :                                      bbbbbb                 bbbb     b              bbb            

queryA       202:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 301
                :****************************************************************************************************:
6xbh_A_1     204:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 303
SecStr          :HHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHHH:    
ExpBur          :bbbbbbbbbbbeeeeeebebeeebeeeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbeebbeeebeeeebbebeebebbbbbebbeeeee:    

queryA       302:GVTF: 305
                :****:
6xbh_A_1     304:GVTF: 307
SecStr          :T   :    
ExpBur          :eeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123