#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xhn_B_1_E_1

Protein Model on 6xhn_B_1_E_1 (TEMPLATE: 6xhn )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA
2 b E 1 (B) non-polymer(V3D) (3S)-3-{[N-(4-methoxy-1H-indole-2-carbonyl)-L-leucyl]amino}-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2-cyanobenzoate 41H 49M 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 168P 172H 188R 189Q 190T 191A (identity: 100.0 %/95.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xhn_B_1 identity=95.4%
queryA         3:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK: 102
                :******************************** ********** ****************** ******************** * ***** ********:
6xhn_B_1       4:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYK: 103
SecStr          :        HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTT SS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  EEE:    
ExpBur          :eeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebbeeeeebebebeeeeebbbebebeeebeebbeee:    
Contact         :                                      b       b                                                     

queryA       103:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV: 202
                :******************************* ********************************************* ********************* :
6xhn_B_1     104:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITL: 203
SecStr          :E    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B HH:    
ExpBur          :eeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebebbb:    
Contact         :                                     bbbbbb                 bbbb b   b               bbbb           

queryA       203:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG: 302
                :**************************************************************** *********  ******  ****************:
6xhn_B_1     204:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMXXRTILGSTILEDEFTPFDVVRQCSG: 303
SecStr          :HHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  --  BTTBSS   S  HHHHHHHHT :    
ExpBur          :bbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeebbeebeebbeeeeeebeebbbbbbebbeeee--eebeeeeeeebbbbbebbeeeeee:    

queryA       303:VT: 304
                :**:
6xhn_B_1     304:VT: 305
SecStr          :  :    
ExpBur          :ee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123