#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7cbt_A_1_B_1

Protein Model on 7cbt_A_1_B_1 (TEMPLATE: 7cbt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [298 aa] Replicase polyprotein 1ab :R1AB_SARS2
2 b B 1 (B) polymer(polypeptide(L)) [298 aa] Replicase polyprotein 1ab :R1AB_SARS2 4R 5K 6M 7A 9P 10S 11G 14E 122P 123S 124G 125V 126Y 127Q 128C 137K 138G 139S 141L 283G 284S 285A 286L 298R 299Q 301S (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7cbt_A_1 identity=100.0%
queryA         4:RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKF: 103
                :****************************************************************************************************:
7cbt_A_1      31:RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKF: 130
SecStr          :       HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTGGGS  HHHHHHT  GGG EEEETTEEE EEE  EETTEEEEEESS  TT  EEEE:    
ExpBur          :eeebbebeebeebbbbbebeebebbbbbbeeebbbbebbbbeeeebeebebeebbeebeeeebebebeeeebebebeebeebbbebebeeebeeebeeee:    
Contact         :bbbb bbb  b                                                                                         

queryA       104:VRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVN: 203
                :****************************************************************************************************:
7cbt_A_1     131:VRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVN: 230
SecStr          :    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TT  BSSS  SSSS        B HHH:    
ExpBur          :eebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeeebbbbbbebebbeebebeeeebebeeeeebbbb:    
Contact         :                  bbbbbbb        bbb b                                                              

queryA       204:VLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 301
                :**************************************************************************************************:
7cbt_A_1     231:VLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 328
SecStr          :HHHHHHHHHHTT  TT       HHHHHHHHHHTTB    HHHHHHHHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHTT :    
ExpBur          :bbbbbbbbbeeeeeebebeeebeeeebbebbeeeebeebeeebbeebeebbeebebebeebbbbbbebbeeebeeeebeeeeebebbbbbebbeeeee:    
Contact         :                                                                               bbbb           bb b  


Input Residue Numbers for Focused Sites

ex) 2,15,123