#WARNING:no index is registered index 'YP_009725301.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7cbt_B_1_D_1

Protein Model on 7cbt_B_1_D_1 (TEMPLATE: 7cbt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [298 aa] Replicase polyprotein 1ab :R1AB_SARS2
2 b D 1 (B) non-polymer(K36) (1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 41H 140F 141L 142N 143G 144S 145C 163H 164H 165M 166E 167L 168P 172H 189Q (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7cbt_B_1 identity=100.0%
queryA         4:RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKF: 103
                :****************************************************************************************************:
7cbt_B_1      31:RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKF: 130
SecStr          :       HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTSS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  SEEE:    
ExpBur          :eeeebebeebebbbbbbbbeebbbbbbbbeeebbbbbbbbbeeeebeebebeebbeeeeeeebebbeeeeebebebeeeeebbbebebeeebeeebeeee:    
Contact         :                                     b                                                              

queryA       104:VRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVN: 203
                :****************************************************************************************************:
7cbt_B_1     131:VRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVN: 230
SecStr          :    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B HHH:    
ExpBur          :eebeebebbbbbbbbebeeeeeebbbbbbbebbebebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebebeeebebbbb:    
Contact         :                                    bbbbbb                 bbbbbb   b                b              

queryA       204:VLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 301
                :**************************************************************************************************:
7cbt_B_1     231:VLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS: 328
SecStr          :HHHHHHHHHHTS  SS  S    HHHHHHHHHTT B    SSSTTTSHHHHHHHS  HHHHHHHHHHHTTS STT  BTTBSS      HHHHHHH  :    
ExpBur          :bbbbbbbbbeeeeeebbbeeeeeeeebeeebeeeebeebeeeebeebbebbeebebebeebbbbbbebbeeebeeeebeeeeebebbbbbebbeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123