#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2xyq_A_1_G_1

Protein Model on 2xyq_A_1_G_1 (TEMPLATE: 2xyq )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [287 aa] PUTATIVE 2'-O-METHYL TRANSFERASE :R1AB_CVHSA
2 b G 1 (A) non-polymer(NA) SODIUM ION 59L 60A 164G 165G 166S 210N (identity: 100.0 %/92.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2xyq_A_1 identity=92.8%
queryA         1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
                : ******************************  *  ****************************************************************:
2xyq_A_1       1:ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
SecStr          : HHHHSSEEE  HHHHT           S    TTS TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEES:    
ExpBur          :eeebeebbbebeeebbeeeeeeeebeeeeeeeeebbeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbeeeeeebbbbebbeebbbeebebbbbbe:    
Contact         :                                                          bb                                        

queryA       101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
                :**********************************    ************** **** ******** * ****************** ************:
2xyq_A_1     101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPRXXXVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNAS: 200
SecStr          :S  B SSSEEEES GGG   SS EEEEEE      ---  S      THHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEEGGGTT:    
ExpBur          :eebeeebeeebeeebeebebebebbbbbbbbeeee---eeeebeeeeebbebbbebbeeebbbbbbbbbbbbbebbbbebbebbbbbbebbbbbbbbbbe:    
Contact         :                                                               bbb                                  

queryA       201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVI: 290
                :******** ****** ****** ***************************************** ****** *** ************* :
2xyq_A_1     201:SSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVV: 290
SecStr          :SS EEEEEEEE SS SS   HHHHHHHHHHHHHHS      GGGG  TT S      EEE   GGG  HHHHHHHHTT EEE        :    
ExpBur          :bbbbbbbbbbbbeeeeeebebeebbbbbbebbbeeebeebbebbeeeeebebeeeebeeeebeeeebeeebeeebeebebbbbeeeeeee:    
Contact         :         b                                                                                          


Input Residue Numbers for Focused Sites

ex) 2,15,123