#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2xyr_A_1_E_1

Protein Model on 2xyr_A_1_E_1 (TEMPLATE: 2xyr )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [286 aa] PUTATIVE 2'-O-METHYL TRANSFERASE :R1AB_CVHSA
2 b E 1 (A) non-polymer(CL) CHLORIDE ION 66R 122N 284E 286N (identity: 100.0 %/92.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2xyr_A_1 identity=92.8%
queryA         3:QAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLND: 102
                :*****************************  *  ******************************************************************:
2xyr_A_1       3:QAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLND: 102
SecStr          : TTSSEEE  HHHHT           S    TTS TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEESS :    
ExpBur          :eeeebbbebeeebbeeeeeeeebeeeeeeeeeebeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbbeeeeebbbbebbeebbbeebebbbbbeee:    
Contact         :                                                               b                                    

queryA       103:FVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSS: 202
                :********************************     ************* **** ******** * ****************** **************:
2xyr_A_1     103:FVSDADSTLIGDCATVHTANKWDLIISDMYDPRXXXXTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSS: 202
SecStr          : B SSSEEEES GGG  BSS EEEEEE      ----        THHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEEGGGTTSS:    
ExpBur          :beeebeeebeeebeebebebebbbbbbbbeeee----eeebeeeeebbebbbebbeeebbbbbbbbbbbbbebbbbebbebbbbbbebbbbbbbbbbebb:    
Contact         :                   b                                                                                

queryA       203:EAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISS: 292
                :****** ****** ****** ***************************************** ****** *** ************* **:
2xyr_A_1     203:EAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSS: 292
SecStr          : EEEEEEEE SS SS   HHHHHHHHHHHHHH       GGGG  TT S      EEE   GGG  HHHHHHHHTT EEES      B  :    
ExpBur          :bbbbbbbbbbeeeeeebebeebbbbbbebbbeeebeebbebbeeeeebebeeeebeeeebeeeebeeebeeebeebebbbbeeeeeeeee:    
Contact         :                                                                                 b b                


Input Residue Numbers for Focused Sites

ex) 2,15,123