#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2xyv_A_1_F_1

Protein Model on 2xyv_A_1_F_1 (TEMPLATE: 2xyv )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [285 aa] PUTATIVE 2'-O-METHYL TRANSFERASE :R1AB_CVHSA
2 b F 1 (A) non-polymer(CL) CHLORIDE ION 219I 220D 223V(T) 224M (identity: 75.0 %/92.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2xyv_A_1 identity=92.4%
queryA         2:SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLN: 101
                :******************************  *  *****************************************************************:
2xyv_A_1       2:SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLN: 101
SecStr          : GGGSSEEE  HHHHT        S  S     SS TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSS HHHHHHHHHS TT EEEEEESS:    
ExpBur          :eeeeebbbebeeebbeeeeeeeebeeeeeeebeebeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbebeeeebbbbebbeebbbeebebbbbbee:    

queryA       102:DFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASS: 201
                :*********************************      ************ **** ******** * ****************** *************:
2xyv_A_1     102:DFVSDADSTLIGDCATVHTANKWDLIISDMYDPXXXXXXKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASS: 201
SecStr          :    SSSEEEES GGG EESS EEEEEE     ------       THHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHGGGEEEEEEEEEGGGTTS:    
ExpBur          :ebeeebeeebeeebeebebebebbbbbbbbeee------eebeeeeebbebbbbbbeeebbbbbbbbbbbbbebbbbebbebbbbbbebbbbbbbbbbeb:    

queryA       202:SEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISS: 292
                :******* ****** ****** ***************************************** ****** *** ************* **:
2xyv_A_1     202:SEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSS: 292
SecStr          :S EEEEEEEE SS SS   HHHHHHHHHHHHHHS      GGGG  TT S      EEE   GGG  HHHHHHHHTT EEES      EE :    
ExpBur          :bbbbbbbbbbbeeeeeebebeebbbbbbebbbeeebeebbebbeeeeebebeeeebeeeebeeeebeeebeeebeebebbbbeeeeeebee:    
Contact         :                 bb  bb                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123