#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3r24_A_1_B_1

Protein Model on 3r24_A_1_B_1 (TEMPLATE: 3r24 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [292 aa] 2'-O-methyl transferase :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [121 aa] Non-structural protein 10 and Non-structural protein 11 :R1A_CVHSA 39G 40I 41M 44V 48T 76K 78V 80P 83A 84V 86R 87Q 91T 102D 104V 105S 106D 107A 244L 247M 248S (identity: 100.0 %/93.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3r24_A_1 identity=93.5%
queryA         3:QAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLND: 102
                :*****************************  *  ******************************************************************:
3r24_A_1      49:QAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLND: 148
SecStr          : TTSSEEE  HHHHT             S  TTS TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEESS :    
ExpBur          :eeeebbbebeeebbeeeeeeeebeeeeeeeeeebeeeeebeebbbbbbbbbbeebebbbbeebbbbbbbbbeeeeebbbbebbeebbbeebebbbbbeee:    
Contact         :                                    bbb  b   b                           b b b  bb bb   b          b

queryA       103:FVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSS: 202
                :******************************** ** ************** **** ******** * ****************** **************:
3r24_A_1     149:FVSDADSTLIGDCATVHTANKWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSS: 248
SecStr          : B SSSEEEES GGGEEESS EEEEEE    TTS SS S      THHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEEGGGTTSS:    
ExpBur          :beeebeeebebebeebebebebbbbbbbbeeeeeeeeeeebebeeebbebbbebbeeebbbbbbbbbbbbbbbbbbebbebbbbbbebbbbbbbbbbebb:    
Contact         : bbbb                                                                                               

queryA       203:EAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDV: 294
                :****** ****** ****** ***************************************** ****** *** ************* *** :
3r24_A_1     249:EAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDI: 340
SecStr          : EEEEEEEE SS SS   HHHHHHHHHHHHHH       GGGG  TT S      EEE   GGG  HHHHHHHHTT EEE       EEE  :    
ExpBur          :bbbbbbbbbbeeeeeebebeebbbbbbebbbeeebeebbebbeeeeebebeeeebeeeeeeeeebeeebbeebeebebbbbeeeeeebeeee:    
Contact         :                                         b  bb                                                      


Input Residue Numbers for Focused Sites

ex) 2,15,123