#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5yn8_A_1_B_1

Protein Model on 5yn8_A_1_B_1 (TEMPLATE: 5yn8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [281 aa] nsp16 protein :K0BWD0_9BETC
2 b B 1 (B) polymer(polypeptide(L)) [117 aa] nsp10 protein :K4LC41_9BETC 39G 40I(V) 44V(I) 48T(M) 76K 78V(I) 80P 83A(S) 84V 86R 87Q 89L 90P 91T 102D(E) 104V 105S 106D 107A 244L 247M(L) 251P(Q) (identity: 63.6 %/63.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5yn8_A_1 identity=63.7%
queryA         2:SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLN: 101
                :*  * ** *** * * *   ** * * *       * *  ** *** ******** ***** ************** **** ********     * ***:
5yn8_A_1       2:SADWKPGHAMPSLFKVQNVNLERCELANXXXXIPMPXGVHMNIAKYMQLCQYLNTCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLN: 101
SecStr          : GGGSSEEE  HHHHT            ----    -   HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEESS:    
ExpBur          :eeeeebbbebeeebbeeeeeeeebeeee----eeee-eeeebebbbbbbbbbbeebebbbbeebbbbbbbbeeeeeebbbbebbeebbbeebebbbbbee:    
Contact         :                                     bb   b   b                           b b b  bb bb bbb          

queryA       102:DFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASS: 201
                : ****** ** *** **      ** *******        * **  **** *  *   ****************   ** *** ***** * ** ****:
5yn8_A_1     102:EFVSDADITLFGDCVTVRVGQQVDLVISDMYDPTXXXXXXSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVELYELMGKFAWWTVFCTNANASS: 201
SecStr          :  B S SEEEES GGGEEE S EEEEEE      ------      THHHHHHHHHHHSEEEEEEEEEEE SSS  HHHHHHGGGEEEEEEEEESTTTTS:    
ExpBur          :ebebebeeebeeebeebebeeebbbbbbbbeeee------ebeeeeebbebbbebbeeebbbbbbbbbbbbbebbbeebbebbbbbbebbbbbbbbbbee:    
Contact         :b bbbb                                                                                              

queryA       202:SEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD: 293
                :** ** * ****   * ***  **********  *  ** ***** *** *** ** *  *** ***    **** * * ** *     * *:
5yn8_A_1     202:SEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTD: 293
SecStr          :S EEEEEEEE SS SS   HHHHHHHHHHHHHH       GGGS  TT S       EE   GGG  HHHHHHHHTT  EES  S   EEE :    
ExpBur          :bbbbbbbbbbbeeeeeebebeebbbbbbebbeeeebeebeebbeeeeebebeeeebeeeeeeeeebeeebeeebeebebbbbbeeebebeee:    
Contact         :                                          b  b   b                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123