#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5ynf_A_1_C_1

Protein Model on 5ynf_A_1_C_1 (TEMPLATE: 5ynf )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [293 aa] nsp16 protein :K0BWD0_9BETC
2 b C 1 (A) non-polymer(GTA) P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE 25C 26D(E) 27L 30Y 31G(K) 46K 132Y 134P 137K 139V 170K 172T 173E 174H 175S 198N 201S 202S 203E (identity: 89.5 %/65.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5ynf_A_1 identity=65.9%
queryA         1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
                : *  * ** *** * * *   ** * * **  *   * *  ** *** ******** ***** ************** **** ********     * **:
5ynf_A_1       1:ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDL: 100
SecStr          : HHHHSSEEE  HHHHT          TTTT     GGG  HHHHHHHHHHHHHTTTT    TT EEEEES  BTTTB HHHHHHHHHS TT EEEEEES:    
ExpBur          :eeeeeebbeebeeebbeeeeeeeebebebeeeebebeeeeeebebbbbbbbbbbeebebbbbeebbbbbbbbeeeeeebbbbebbeebbbeebebbbbee:    
Contact         :                        bbb  bb              b                                                      

queryA       101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
                :* ****** ** *** **      ** ******* *****  * **  **** *  *   ****************   ** *** ***** * ** ***:
5ynf_A_1     101:NEFVSDADITLFGDCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVELYELMGKFAWWTVFCTNANAS: 200
SecStr          :S    SSSEEEES GGGEEE S EEEEEE    GGGG   SS     TTHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHGGGEEEEEEEEEGGGTT:    
ExpBur          :eebeeebeeebeeebeebbbebebbbbbbbbeeeebeeeeeebeeeeebbebbbebbeebbbbbbbbbbbbbbbbbbeebbebbbbbbebbbbbbbbbbb:    
Contact         :                               b b  b b                              b bbbb                      b  

queryA       201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD: 293
                :*** ** * ****   * ***  **********  *  ** ***** *** *** ** *  *** ***    **** * * ** *     * *:
5ynf_A_1     201:SSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTD: 293
SecStr          :SS EEEEEEEE SS SS   HHHHHHHHHHHHHH       GGGS  TT S       EE   GGG  HHHHHHHHTT  EES  S   EEE :    
ExpBur          :bbbbbbbbbbbbeeeeeebebeebbbbbbebbeeeebebbbebbeeeeebebeeeebeeeeeeeeeeeeebeeebeebebbbbbeeeeebeee:    
Contact         :bbb                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123