#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5ynq_A_1_C_1

Protein Model on 5ynq_A_1_C_1 (TEMPLATE: 5ynq )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [291 aa] nsp16 protein :K0BWD0_9BETC
2 b C 1 (A) non-polymer(SAH) S-ADENOSYL-L-HOMOCYSTEINE 43N 47Y 71G 72A 73G 74S 80P 81G 98S(N) 99D 100L 101N 113G 114D 115C 130D 131M 132Y 149F (identity: 94.7 %/65.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5ynq_A_1 identity=65.5%
queryA         1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
                : *  * ** *** * * *   ** * * **  *   *    ** *** ******** ***** ************** **** ********     * **:
5ynq_A_1       1:ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPXXVHMNIAKYMQLCQYLNTCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDL: 100
SecStr          : HHHHSSEEE  HHHHT          TTTT      --  HHHHHHHHHHHHHTTS     TT EEEEES   TTS  HHHHHHHHHS TT EEEEEES:    
ExpBur          :eeeeeebbbebeeebbeeeeeeeebebebeeeebeee--eeeeebbbbbbbbbbeebebbbbeebbbbbbbbeeeeeebbbbebbeebbbeebebbbbbe:    
Contact         :                                          b   b                       bbbb     bb                bbb

queryA       101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
                :* ****** ** *** **      ** ******* *****  * **  **** *  *   ****************   ** *** ***** * ** ***:
5ynq_A_1     101:NEFVSDADITLFGDCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVELYELMGKFAWWTVFCTNANAS: 200
SecStr          :S    S SEEEES GGGEEE S EEEEEE    GGGG   S      TTHHHHHHHHHHSEEEEEEEEEEE SSS  HHHHHHGGGEEEEEEEEESTTTT:    
ExpBur          :eebeeebeeebeeebeebebebebbbbbbbbeeeebeeeeeebeeeeebbebbbebbeebbbbbbbbbbbbbbbbbbbebbebbbbbbebbbbbbbbbbb:    
Contact         :b           bbb              bbb                b                                                   

queryA       201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSD: 293
                :*** ** * ****   * ***  **********  *  ** ***** *** *** ** *  *** ***    **** * * ** *     * *:
5ynq_A_1     201:SSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTD: 293
SecStr          :SS EEEEEEEE SS SS   HHHHHHHHHHHHHH       GGGG  TT S       EE   GGG  HHHHHHHHTT  EES  S   EEE :    
ExpBur          :ebbbbbbbbbbbeeeeeebebebbbbbbbebbeeeebebbeebbeeeeebebeeeebeeeeeeeeeeeeebeeebeebebbbbbeeeeebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123