#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6w75_A_1_O_1

Protein Model on 6w75_A_1_O_1 (TEMPLATE: 6w75 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [297 aa] SARS-CoV-2 NSP16 :R1AB_SARS2
2 b O 1 (A) non-polymer(FMT) FORMIC ACID 16K 190W 216R 217E 219I (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w75_A_1 identity=100.0%
queryA         2:SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLN: 101
                :****************************************************************************************************:
6w75_A_1       5:SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLN: 104
SecStr          :  TTSSEEE  HHHHT          TTTT      TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEESS:    
ExpBur          :eebeebbbebeeebbeeeeeeeebebebeeeebeeeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbeeeeeebbbbebbeebbbeebebbbbbee:    
Contact         :              b                                                                                     

queryA       102:DFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASS: 201
                :****************************************************************************************************:
6w75_A_1     105:DFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASS: 204
SecStr          :  B  SSEEEES GGGEEESS EEEEEE    THHHHS        SHHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEEGGGTTS:    
ExpBur          :ebeeebeeebeeebeebebebebbbbbbbbeeeebeeeeeebebeeebbebbbbbbeeebbbbbbbbbbbbbebbbbebbebbbbbeebbbbbbbbbbbe:    
Contact         :                                                                                        b           

queryA       202:SEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 298
                :*************************************************************************************************:
6w75_A_1     205:SEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 301
SecStr          :S EEEEEEEE SS SS   HHHHHHHHHHHHHHS      GGGG  TT S      EEE   GGG  HHHHHHHHTT EEES      EEE      :    
ExpBur          :bbbbbbbbbbbeeeeeebebebbbbbbbebbeeeebebbbebbeeeeebebeeeebeeeeeeeeeeeeebbeebeebebbbbeeeeeeeeeeeeeee:    
Contact         :              bb b                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123