#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6w75_C_1_U_1

Protein Model on 6w75_C_1_U_1 (TEMPLATE: 6w75 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [292 aa] SARS-CoV-2 NSP16 :R1AB_SARS2
2 b U 1 (C) non-polymer(NA) SODIUM ION 158Q 211Y (identity: 100.0 %/98.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w75_C_1 identity=98.3%
queryA         1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
                :****************************************************************************************************:
6w75_C_1       4:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 103
SecStr          : GGGGSSEEE  HHHHT          TTTT      TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEES:    
ExpBur          :eeebeebbbebeeeebeeeeeeeebebebeeeebeeeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbbeeeeebbbbebbeebbbeebebbbbbe:    

queryA       101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
                :***********************************     ************************************************************:
6w75_C_1     104:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKXXXXXKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 203
SecStr          :S  B  SSEEEES GGGEEESS EEEEEE      -----       SHHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEESTTTT:    
ExpBur          :eebeeebeeebeeebeebebebebbbbbbbbeeee-----eebebeeebbebbbebbeeebbbbbbbbbbbbbebbbbebbebbbbbeebbbbbbbbbbb:    
Contact         :                                                         b                                          

queryA       201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN: 297
                :*************************************************************************************************:
6w75_C_1     204:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN: 300
SecStr          :SS EEEEEEEE SS SS   HHHHHHHHHHHHHHS      GGGG  TT S      EEE   GGG  HHHHHHHHTT EEES      EEE     :    
ExpBur          :ebbbbbbbbbbbeeeeeebebebbbbbbbebbeeeebebbbebbeeeeebebeeeebeeeeeeeeeeeeebbeebeebebbbbeeeeeeeeeeeeee:    
Contact         :          b                                                                                         


Input Residue Numbers for Focused Sites

ex) 2,15,123