#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wks_A_1_D_1

Protein Model on 6wks_A_1_D_1 (TEMPLATE: 6wks )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (AAA) polymer(polypeptide(L)) [298 aa] 2'-O-methyltransferase :R1AB_SARS2
2 b D 1 (AAA) non-polymer(ADN) ADENOSINE 13N 56T 57L 58T 189W 209C (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wks_A_1 identity=100.0%
queryA         1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
                :****************************************************************************************************:
6wks_A_1       1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
SecStr          : GGGGSSEEE  HHHHT          TTTT     STT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSS HHHHHHHHHS TT EEEEEES:    
ExpBur          :eeebeebbbebeeeebeeeeeeeebebebeeeebeeeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbeeeeeebbbbebbeebbbeebebbbbbe:    
Contact         :            b                                          bbb                                          

queryA       101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
                :****************************************************************************************************:
6wks_A_1     101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
SecStr          :S     SSEEEES GGGEEESS EEEEEE    GGGG   S      THHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEEGGGTT:    
ExpBur          :eebeeebeeebebebeebebebebbbbbbbbeeeebeeeeeebebeeebbebbbebbeeebbbbbbbbbbbbbbbbbbebbebbbbbbebbbbbbbbbbb:    
Contact         :                                                                                        b           

queryA       201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 298
                :**************************************************************************************************:
6wks_A_1     201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 298
SecStr          :SS EEEEEEEE SS SS   HHHHHHHHHHHHHH       GGGG  TT S      EEE   GGG  HHHHHHHHTT EEES  S   EEE      :    
ExpBur          :ebbbbbbbbbbbeeeeeebebeebbbbbbebbeeeebebbbebbeeeeebebeeeebeeeebeeeeeeeebbeebeebebbbbeeeeeeeeeeeeeee:    
Contact         :        b                                                                                           


Input Residue Numbers for Focused Sites

ex) 2,15,123