#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wvn_A_1_T_1

Protein Model on 6wvn_A_1_T_1 (TEMPLATE: 6wvn )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [299 aa] 2'-O-methyltransferase :R1AB_SARS2
2 b T 1 (A) non-polymer(SO4) SULFATE ION 41M 42M 76K (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wvn_A_1 identity=100.0%
queryA         1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
                :****************************************************************************************************:
6wvn_A_1       4:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 103
SecStr          : GGGGSSEEE  HHHHT          TTTT      TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEES:    
ExpBur          :eeebeebbbebeeeebeeeeeeeebebebeeeebeeeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbbeeeeebbbbebbeebbbeebebbbbbe:    
Contact         :                                        bb                                 b                        

queryA       101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
                :****************************************************************************************************:
6wvn_A_1     104:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 203
SecStr          :S  B SSSEEEES GGGEE SS EEEEEE    GGGG   S      THHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEEGGGTT:    
ExpBur          :eebeeebeeebeeebeebebebebbbbbbbbeeeebeeeeeebeeeeebbebbbbbbeeebbbbbbbbbbbbbbbbbbebbebbbbbbebbbbbbbbbbb:    

queryA       201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 298
                :**************************************************************************************************:
6wvn_A_1     204:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 301
SecStr          :SS EEEEEEEE SS SS   HHHHHHHHHHHHHHS      GGGG  TT S      EEE   GGG  HHHHHHHTTT EEES       EE      :    
ExpBur          :ebbbbbbbbbbbeeeeeebebebbbbbbbebbeeeebeebbebbeeeeebebeeeebeeeeeeeeebeeebbeebeebebbbbeeeeeeeeeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123