#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7bq7_A_1_B_1

Protein Model on 7bq7_A_1_B_1 (TEMPLATE: 7bq7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [297 aa] SARS-CoV-2 nsp16 :R1AB_SARS2
2 b B 1 (B) polymer(polypeptide(L)) [113 aa] SARS-CoV-2 nsp10 :R1AB_SARS2 38K 39G 40I 41M 44V 48T 76K 78V 80P 83A 84V 86R 87Q 91T 104V 105S 106D 107A 244L 247M 248S (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7bq7_A_1 identity=100.0%
queryA         1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
                :****************************************************************************************************:
7bq7_A_1       1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
SecStr          :  STTSSEEE  HHHHT          TTTT      TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEES:    
ExpBur          :eeebeebbbebeeeebeeeeeeeebebebeeeebeeeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbeeeeeebbbbebbeebbbeebebbbbbe:    
Contact         :                                     bbbb  b   b                           b b b  bb bb   b         

queryA       101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
                :****************************************************************************************************:
7bq7_A_1     101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
SecStr          :S  B  SSEEEES GGGEEESS EEEEEE    GGG  TTS      THHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEEGGGTT:    
ExpBur          :eebeeebeeebeeebeebebebebbbbbbbbeeeebeeeeeebebeeebbebbbebbeeebbbbbbbbbbbbbbbbbbebbebbbbbbebbbbbbbbbbb:    
Contact         :   bbbb                                                                                             

queryA       201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN: 297
                :*************************************************************************************************:
7bq7_A_1     201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN: 297
SecStr          :SS EEEEEEEE SS SS   HHHHHHHHHHHHHHS      GGGG  TT S      EEE   GGG  HHHHHHHHTT EEES      EEE     :    
ExpBur          :ebbbbbbbbbbbeeeeeebebebbbbbbbebbeeeebebbbebbeeeeebebeeeebeeeebeeeeeeeebbeebeebebbbbeeeeeeeeeeeeee:    
Contact         :                                           b  bb                                                    


Input Residue Numbers for Focused Sites

ex) 2,15,123