#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7jyy_A_1_N_1

Protein Model on 7jyy_A_1_N_1 (TEMPLATE: 7jyy )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [300 aa] 2'-O-methyltransferase :R1AB_SARS2
2 b N 1 (A) non-polymer(FMT) FORMIC ACID 6Q 7P 8G 53Y (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7jyy_A_1 identity=100.0%
queryA         1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
                :****************************************************************************************************:
7jyy_A_1       3:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 102
SecStr          :SGGGGSSEEE  HHHHT          TTTT      TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEES:    
ExpBur          :eeebeeebbebeeebbeeeeeeeebebebeeeebeeeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbbeeeeebbbbebbeebbbeebebbbbbe:    
Contact         :     bbb                                            b                                               

queryA       101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
                :****************************************************************************************************:
7jyy_A_1     103:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 202
SecStr          :S  B  SSEEEES GGGEEESS EEEEEE    GGGGS  S      SHHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEEGGGTT:    
ExpBur          :eebeeebeeebeeebeebebebebbbbbbbbeeeebeeeeeebebeeebbebbbebbeeebbbbbbbbbbbbbebbbbebbebbbbbbebbbbbbbbbbb:    

queryA       201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 298
                :**************************************************************************************************:
7jyy_A_1     203:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 300
SecStr          :SS EEEEEEEE SS SS   HHHHHHHHHHHHHHS      GGGG  TT S      EEE   TTT  HHHHHHHHTT EEES      EEE      :    
ExpBur          :ebbbbbbbbbbbeeeeeebebebbbbbbbebbeeeebebbbebbeeeeebebeeeebeeeeeeeeeeeeebbeebeebebbbbeeeeeebeeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123