#WARNING:no index is registered index 'YP_009725311.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7jz0_C_1_F_1

Protein Model on 7jz0_C_1_F_1 (TEMPLATE: 7jz0 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [298 aa] 2'-O-methyltransferase :R1AB_SARS2
2 b F 1 (F) polymer(polyribonucleotide) RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*U)-3') 25C 26D 27L 30Y 33S 34A 36L 42M 43N 46K 74S 75D 76K 130D 132Y 134P 137K 170K 172T 173E 174H 175S 198N 201S 202S 203E (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7jz0_C_1 identity=100.0%
queryA         1:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 100
                :****************************************************************************************************:
7jz0_C_1       3:SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDL: 102
SecStr          : GGGGSSEEE  HHHHT          TTTT      TT  HHHHHHHHHHHHHTTS     TT EEEEES   TTSB HHHHHHHHHS TT EEEEEES:    
ExpBur          :eeebeebbbebeeeebeeeeeeeebebebeeeeeeeeeeeeeeebbbbbbbbbbeebebbbbeebbbbbbbbbeeeeebbbbebbeebbbeebebbbbbe:    
Contact         :                        bbb  b  bb b     bb  b                           bbb                        

queryA       101:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 200
                :****************************************************************************************************:
7jz0_C_1     103:NDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNAS: 202
SecStr          :S  B  SSEEEES GGGEEESS EEEEEE    GGGTT  S      SHHHHHHHHHHHHEEEEEEEEEEE SSS  HHHHHHHTTEEEEEEEEEGGGTT:    
ExpBur          :eebeeebeeebeeebeebebebebbbbbbbbeeeebeeeeeebebeeebbebbbebbeeebbbbbbbbbbbbbebbbbebbebbbbbeebbbbbbbbbbb:    
Contact         :                             b b b  b                                b bbbb                      b  

queryA       201:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 298
                :**************************************************************************************************:
7jz0_C_1     203:SSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN: 300
SecStr          :SS EEEEEEEE SS SS   HHHHHHHHHHHHHHS      GGGG  TT S      EEE   GGG  HHHHHHHHTT EEES      EEE      :    
ExpBur          :ebbbbbbbbbbbeeeeeebebebbbbbbbebbeeeebebbbebbeeeeebebeeeebeeeeeeeeeeeeebbeebeebebbbbeeeeeeeeeeeeeee:    
Contact         :bbb                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123