#WARNING:no index is registered index 'YP_009724392.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5x29_C_1_B_1

Protein Model on 5x29_C_1_B_1 (TEMPLATE: 5x29 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [58 aa] Envelope small membrane protein :VEMP_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [58 aa] Envelope small membrane protein :VEMP_CVHSA 21L 24V 25V 27L 28L 31L 47V 48N (identity: 100.0 %/91.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5x29_C_1 identity=91.4%
queryA         8:ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNL:  65
                :******************************** **  **********  *********:
5x29_C_1      24:ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL:  81
SecStr          :  S  GGGTHHHHHHHHTTHHHHHHHHTTTT HHHHHHHHTT TTSGGGGGTTTTTT :    
ExpBur          :eeeeeeeeeeeeeeeeeeeeeeeeeebeeeeeeeebeeeeeeeeeeeeeeeeeeeeee:    
Contact         :             b  bb bb  b               bb                                                           


Input Residue Numbers for Focused Sites

ex) 2,15,123