Protein Model on 1bqu_B_1_A_1 (TEMPLATE: 1bqu )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (B) polymer(polypeptide(L)) [215 aa] PROTEIN (GP130) :IL6RB_HUMAN
2 b A 1 (A) polymer(polypeptide(L)) [208 aa] PROTEIN (GP130) :IL6RB_HUMAN 252R(K) 254E(N) 267T(Q) 269M(P) 270V(P) 271K(E) 293R 298F(D) 300Q(K) 303W (identity: 20.0 %/29.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1bqu_B_1 identity=29.9%
queryA       112:VPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKF: 202
                : *** *  ***          *** * * *      * *      **    *                **        *  * *   *        *   :
1bqu_B_1       6:LPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA----------KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVT:  90
SecStr          :      EEEEEEEETT-S  EEEEE  S  SS  EEEEEEEETTEE   EE ---------- SS TTEEE SS----   TTS EEEEEEEEETTEEEE:    
ExpBur          :eebeebeebebbbebe-eebebebebeeebeeebebbbebeeeeeebeebeb----------eeeeeebbebeb----eeebeeebebbbbbebeeeeee:    

queryA       203:SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVIHDAWSGLRHVVQLRAQEEFG: 299
                :*    *       * ** *  *         *  **  *     *   *     **     *       *           *       *   *   * *:
1bqu_B_1      91:SDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDG: 188
SecStr          :   EEE GGGSEE    EEEEEE  TT TT EEEEEE  GG--GGTS EEEEEEEEETT SS EE  GGGS S  SEEEE S  TT EEEEEEEEEETTS:    
ExpBur          :beeeebbbbeebebeebeebebeebeeebebbebebebbeb--eeebebebbbbebbeeeeeeeebeeeebeeeeeebebeebeeeeebbbbbebbbeee:    
Contact         :                                                 b b            b bbb  b                     b    b 

queryA       300:QGEWSEWSPEAMG: 312
                : * ** ** ** *:
1bqu_B_1     189:KGYWSDWSEEASG: 201
SecStr          : S        EEE:    
ExpBur          :eeeebeebeebeb:    
Contact         :b  b                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123