Protein Model on 1f45_A_1_B_1 (TEMPLATE: 1f45 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 1 (A) polymer(polypeptide(L)) [282 aa] INTERLEUKIN-12 BETA CHAIN :I12B_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [133 aa] INTERLEUKIN-12 ALPHA CHAIN :I12A_HUMAN 126P(Y) 175S 179A 180V(C) 181P 182E(A) 184D(E) 211C(R) 246S(T) 247S 248F(Y) 249Y(F) 250R(S) 295Q 296E(D) 297E(R) 298F(Y) 299G(Y) 300Q(S) 301G(S) (identity: 25.0 %/27.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1f45_A_1 identity=27.4%
queryA        39:PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVD--VPPEEPQLSCF: 122
                :**  * ***    **      * *         *   * *  *        * * * *                          * *   *     * * :
1f45_A_1      20:PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCXXXXXXXSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCE: 110
SecStr          :  EEE  B SS--   SS- EEEE------TT  S  EESSB  EEE SGGG SBEE -------   EEEEEEEETTEE   SS    TTTSS   EEE:    
ExpBur          :eeeebebebee--eeeee-bebeb------eeeeeeeeeeeebeeebbeeeebbebee-------eebebbbbbeeeeeebeebbeebbeeeeebbbebe:    

queryA       123:RKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ: 206
                : *       * *                *       *  *  *                 ** * *  *   * *    *  *  *  *         * :
1f45_A_1     111:AKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAEXXXXXXXEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYENYTS: 203
SecStr          :BSSTTSEEEEEEEES  SS EEEEEEEE SSS  BEEE   EEEE ------- E----EEEEEEEETT---  TT    S EEEEEEEEETTEEEEEEE:    
ExpBur          :bebbebebebbbbbebeeebebebebbbbeeeeeebeeeeeeeeee-------ee----ebbbebebee---eeeeeebeeebbbebebbbeebbbebeb:    
Contact         :   b                                                                b   bbbb b                      

queryA       207:TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS: 304
                : *    *  **** *        * *   * *  *  *    *   * *                  *     **             ***       **:
1f45_A_1     204:SFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQXXXXXXXKDRVFTDKTSATVI----CRXXXSISVRAQDRYYSSSWS: 298
SecStr          :EE GGGSB     EEEE    -SS SEEEEEEE  TTS SSTTTS EEEEEEE -------  EEEESSSEEEEE----  --- EEEEEEESSS     :    
ExpBur          :ebebeebbebeebeebeeeee-eeeeebebebebbeebbeeeeebbbbbbbbbe-------eeeeebeeeebebe----be---ebbbbbbbeeebeeeb:    
Contact         :    b                                  bb bbbb                                            bbbbbbb   

queryA       305:EWS: 307
                :** :
1f45_A_1     299:EWA: 301
SecStr          :  E:    
ExpBur          :eeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123