Protein Model on 1f6f_B_1_A_1 (TEMPLATE: 1f6f )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (B) polymer(polypeptide(L)) [195 aa] PROLACTIN RECEPTOR :PRLR_RAT
2 b A 1 (A) polymer(polypeptide(L)) [183 aa] PLACENTAL LACTOGEN :CSH_SHEEP 128S(E) 157P(E) 184D(S) 185S(I) 186S(K) 187F(I) 207T(Y) 209Q(D) 211C(T) 212G(Y) 243S(D) 244W(V) 245N(K) 246S(T) 247S(G) 248F(W) 249Y(F) 250R(T) 252R(E) 275H 297E(D) 300Q(H) (identity: 4.5 %/24.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1f6f_B_1 identity=24.7%
queryA       116:EPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGCGIL: 214
                : *     *        * * *     * *   *   *      *     *     *   **            **         **  *         * :
1f6f_B_1       6:KPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSK----EGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIV: 101
SecStr          :  EEEEEEBSSSS EEEEEE    TTS  EEEEEEEE----TTEEEEEE S SSTT TTEEEE TTT  SS EEEEEEEEEETTEEEE   EEEEGGG B:    
ExpBur          :ebebeebbbebbebbbbebeeeeeeebebebebbbeb----eeeeeeeebeeeeeeeeebbbbeeeebebeeebebbbebebeeeeeebeebebbbbebb:    
Contact         :            b                            b                          bbbbb                   b b bb  

queryA       215:QPDPPANIT--VTAVARNPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSGLRHVVQLRAQEEFGQGEWSEWSP: 308
                : * ** * *  *         * * *  *              * *   *       *      *       *   *    ** *       * ** ** :
1f6f_B_1     102:EPEPPRNLTLEVKXXXXKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAE---EWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPD--HGYWSRWSQ: 196
SecStr          :     EEEEEEE ----    EEEEEE  TTS TTTTSS EEEEEEEEESS S---  EEEEEET SEEEE    TT EEEEEEEEEES--SS       :    
ExpBur          :ebeebeebeeeee----eeeebebebeebeebeeeeeebebbbbbebbbeeee---eeeeeebeeeeeeebeebeeeeebbbbbebbbe--eeeebeebe:    
Contact         :                                bbbbbbbb b                      b                       b  b        

queryA       309:EA: 310
                :* :
1f6f_B_1     197:ES: 198
SecStr          : E:    
ExpBur          :ee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123