Protein Model on 1i1r_A_1_B_1 (TEMPLATE: 1i1r )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 1 (A) polymer(polypeptide(L)) [301 aa] INTERLEUKIN-6 RECEPTOR BETA CHAIN :IL6RB_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [167 aa] VIRAL IL-6 :Q98823_HHV8 148L(W) 150V(T) 185S 186S(T) 187F(V) 188Y 189I(F) 190V 242H(S) 247S 248F(V) (identity: 36.4 %/28.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1i1r_A_1 identity=28.2%
queryA       106:VHLLVDVPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV----AS: 196
                :       *** *  ***          *** * * *      * *      **    *                **        *  * *   *      :
1i1r_A_1      96:ITIISGLPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA----------KRDTPTSCTVDY----STVYFVNIEVWVEAEN: 180
SecStr          :EEEEEE      EEEEEEEETT-S  EEEEE  S  SS  EEEEEEEETTEE   EE ---------- SS TTEEE SS----   TTS EEEEEEEEE:    
ExpBur          :bebebbbebeebeebebbbbbe-eebebebeeeeebebeeebbbbbeeeeeebeebeb----------eeeeeebbebeb----ebebeeebebbbebeb:    
Contact         :                                               b b                                  bbbbbb          

queryA       197:SVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVIHDAWSGLRHVVQLR: 293
                :  *   *    *       * ** *  *         *  **  *     *   *     **     *       *           *       *   *:
1i1r_A_1     181:ALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR: 278
SecStr          :TTEEEE   EEE GGGGEE    EEEEEE  SSSSS EEEEEE  GG--GGTS EEEEEEEEETT SS EE  GGGG S  SEEEE S  TT EEEEEEE:    
ExpBur          :eeeeeebeeeebbbbeebbbeebeebebeeeeeebebbebebebbeb--eeebebbbbbbebeeeeeeeeebeeeebeeeeeebebeebeeeeebbbebe:    
Contact         :                                             b    bb                                                

queryA       294:AQEEFGQGEWSEWSPEAMGTPWTE: 317
                :   * * * ** ** ** *     :
1i1r_A_1     279:CMKEDGKGYWSDWSEEASGITYED: 302
SecStr          :EEETTS S        EEEE    :    
ExpBur          :bbbeeeeeeebeebeebebebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123