Protein Model on 1n26_A_2_D_2 (TEMPLATE: 1n26 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 2 (A) polymer(polypeptide(L)) [299 aa] IL-6 Receptor alpha chain :IL6A_HUMAN
2 b D 2 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 220A 221N 239Q 240D 242H (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1n26_A_2 identity=100.0%
queryA        20:LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQL: 119
                :****************************************************************************************************:
1n26_A_2       1:LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQL: 100
SecStr          :  SS        TTEEEE TT  EEEE TTS TT  SEEEEEEE SSSS   EEEEEESSEEEE S  GGG EEEEEESSSS S EEEEEE         :    
ExpBur          :ebbeebeeeeeeeeeeebeeeeebebebeebeeeeeeebebbbeeeeeeeeeeeeebebeeeebeebeeebbbebbbeeeeeebeebebebbeebbebeb:    

queryA       120:SCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP: 219
                :****************************************************************************************************:
1n26_A_2     101:SCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP: 200
SecStr          :EEEBSSTTS EEEEE  SS   TT EEEEEEEEESSSS EEEEEEEEEETTTTEEEEEE   TT   EEEEEEEEEETTEEEE   EEEETTT B     :    
ExpBur          :ebebebbeeebbbebebeeeeeeebebebbbebeeeeeeeeeeeebeeeeeeeebebebebeeebebebebbbbbbbbeeeeebeeeebebeebbebeeb:    

queryA       220:ANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES: 318
                :***************************************************************************************************:
1n26_A_2     201:ANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTES: 299
SecStr          :EEEEEEE TT TT EEEEEE  TT   SSS EEEEEEEEETT S  EEEE GGG SEEEESS  TT  EEEEEEEEETTTBS        EEE      :    
ExpBur          :eebebeeeeeeeeebebebeebeebeeeeeebebbbebbbeeeeeeeeeebeebeeebebeebeeeeebbbbbebbbbeebbebbeebeebebebeeee:    
Contact         :bb                 bb b                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123