Protein Model on 1p9m_A_1_C_1 (TEMPLATE: 1p9m )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 1 (A) polymer(polypeptide(L)) [298 aa] Interleukin-6 receptor beta chain :IL6RB_HUMAN
2 b C 1 (C) polymer(polypeptide(L)) [201 aa] Interleukin-6 receptor alpha chain :IL6RA_HUMAN 227V(S) 228A(E) 235S(K) 250R(I) 272D 274Q(R) 276H(S) 277C(F) 278V(T) 280H(Q) (identity: 10.0 %/28.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1p9m_A_1 identity=28.9%
queryA       106:VHLLVDVPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV----AS: 196
                :       *** *  ***          *** * * *      * *      **    *                **        *  * *   *      :
1p9m_A_1      96:ITIISGLPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA----------KRDTPTSCTVDY----STVYFVNIEVWVEAEN: 180
SecStr          :     B      EEEE  EESS-S BEEEEE  S  SS  EEEEEEEETTEE   EE ---------- TT SS EE SS----    SS EEEEEEEE :    
ExpBur          :bebebbbebeebeebebbbeee-eebebebeeeeebebeeebbbebeeeeeeeeebeb----------eeeeebebebeb----eeeeebebebbbbbeb:    

queryA       197:SVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVIHDAWSGLRHVVQLR: 293
                :  *   *    *       * ** *  *         *  **  *     *   *     **     *       *           *       *   *:
1p9m_A_1     181:ALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR: 278
SecStr          :TT  EE   EEE TTTSEE     S EEE TTT TT EEEE    TT--TTTS EEEEEEEEETT SS EE  TTTTSS  SEEEE S  SS  EEEEEE:    
ExpBur          :eeeeeebeeeebbbbeebebeebeebebeeeeeeeeebebebeebeb--eeebebebbbbebeeeeeeeeebeeeebeeeeeebebeebeeebebbbebe:    
Contact         :                              bb      b              b                     b  b b bbb b             

queryA       294:AQEEFGQGEWSEWSPEAMG: 312
                :   * * * ** ** ** *:
1p9m_A_1     279:CMKEDGKGYWSDWSEEASG: 297
SecStr          :EEETT  S        EEE:    
ExpBur          :bbbeeeeeeebeebeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123