Protein Model on 1p9m_C_1_B_1 (TEMPLATE: 1p9m )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) C 1 (C) polymer(polypeptide(L)) [201 aa] Interleukin-6 receptor alpha chain :IL6RA_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [163 aa] Interleukin-6 :IL6_HUMAN 127L 181P 182E 183G 187F 209Q 212G 247S 248F 249Y 250R 296E 297E 298F 300Q (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1p9m_C_1 identity=100.0%
queryA       115:EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL: 214
                :****************************************************************************************************:
1p9m_C_1       1:EEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGIL: 100
SecStr          :        BSSSSS B      SS   SS   EEEEEE SSSS EEEEEEEEEETTTTEEEE B   TT    EEEEEEEESSS EE    EEE TTSSB:    
ExpBur          :eebebebbbebbeeebbbebebeeebeeebebebebebeeeeeeeeeeeebeeeeeeeebebebebeeebebebebbbbbeeeeeeeebeeeebebeebb:    
Contact         :            b                                                     bbb   b                     b  b  

queryA       215:QPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP: 314
                :****************************************************************************************************:
1p9m_C_1     101:QPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTP: 200
SecStr          :     EEEEEEEETTEEEEEEEEEE  TT   TTS EEEEEEEEETT    EEEE SSS S EEESS  SS  EEEE  EEETTTBS        EEE  :    
ExpBur          :ebeebeebebeeeeeeeeebebebeebeebebeebebebbbebbbeebeeeeeeebeeeeeebebeebeeeeebbbbbbbbbbeeeeeebebbeeeebeb:    
Contact         :                                bbbb                                             bbb b              

queryA       315:W: 315
                :*:
1p9m_C_1     201:W: 201
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123