Protein Model on 1pvh_A_1_E_1 (TEMPLATE: 1pvh )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 1 (A) polymer(polypeptide(L)) [201 aa] Interleukin-6 receptor beta chain :IL6RB_HUMAN
2 b E 1 (A) non-polymer(IOD) IODIDE ION 303W (identity: 100.0 %/29.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1pvh_A_1 identity=29.9%
queryA       112:VPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV----ASSVGSKF: 202
                : *** *  ***          *** * * *      * *      **    *                **        *  * *   *        *   :
1pvh_A_1       2:LPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA----------KRDTPTSCTVDY----STVYFVNIEVWVEAENALGKVT:  86
SecStr          :      EEEEEEEETT-S  EEEEE  S  SS  EEEEEEE SS B   EE ---------- SSSTTEEE SS----   TTS EEEEEEEEETTEEEE:    
ExpBur          :eebeebeebebbbebe-eebebebeeeeebeeeeebbbbbeeeeeebeebeb----------eeeeeeebebeb----eeebeeebebbbbbebeeeeee:    

queryA       203:SKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVIHDAWSGLRHVVQLRAQEEFG: 299
                :*    *       * ** *  *         *  **  *     *   *     **     *       *           *       *   *   * *:
1pvh_A_1      87:SDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDG: 184
SecStr          :   EEE GGGGEE    EEEEEE TTSSSSEEEEEEE  GG--GGTS EEEEEEEEESS SS EE  GGGG S  SEEEEES  SS EEEEEEEEEETTS:    
ExpBur          :beeeebbbbeebbbeebeebebeeeeeeeebbebebebbeb--eeebebebbbbebeeeeeeeeebeeeebeeeeeebebeebeeeeebbbbbebbbeee:    

queryA       300:QGEWSEWSPEAMG: 312
                : * ** ** ** *:
1pvh_A_1     185:KGYWSDWSEEASG: 197
SecStr          : S        EEE:    
ExpBur          :eeeebeebeebeb:    
Contact         :   b                                                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123