Protein Model on 3d48_B_1_E_1 (TEMPLATE: 3d48 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (R) polymer(polypeptide(L)) [195 aa] Prolactin receptor :PRLR_HUMAN
2 b E 1 (R) non-polymer(CO3) CARBONATE ION 122F(C) 123R 213I 215Q (identity: 75.0 %/24.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d48_B_1 identity=24.2%
queryA       112:VPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQG: 210
                : **  *     *        * * *     * *   *          *     *         **            **         ** **       :
3d48_B_1       3:LPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHR----EGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDV:  98
SecStr          :    EEEEEEEEBSSSS EEEEEEEEES    SEEEEEEEE----SS    EE S SSTT TTEEEE GGG  SS EEEEEEEEEETTEEEE   EEEEG:    
ExpBur          :eebbebebeebbbbbbebbbbebeeeeeebebeebebbbeb----eeeeeeeebeeeeeeeeebbbbeeeebebeeebbbebebebeeeebebeeeebbb:    
Contact         :          bb                                                                                        

queryA       211:CGILQPDPPANITVTAVARNPR--WLSVTWQDPH--SWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEW: 306
                :  * *****    *           *   *  *           *  * *   *             *    *     *    ** *       * ** *:
3d48_B_1      99:TYIVQPDPPLELAVEVKXXXXXXPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEI-HFAGQQTEFKILSXXPGQKYLVQVRCKPD--HGYWSAW: 195
SecStr          :GG B     EEEEEE  ------  EEEEEE  TT   TTSS  EEEEEEEEETT SS EE-EEEET SEEEE  --   EEEEEEEEEES--SS     :    
ExpBur          :bebbebeebeebebeee------eebebebeebeebeeeeeebebbbbbebbeeeeeeeee-eebeeeeeeebee--eeeebbbbbebbbe--eeeebee:    
Contact         :  b b                                                                                               

queryA       307:SP: 308
                :**:
3d48_B_1     196:SP: 197
SecStr          :  :    
ExpBur          :be:    


Input Residue Numbers for Focused Sites

ex) 2,15,123