Protein Model on 3d87_B_1_E_1 (TEMPLATE: 3d87 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1] [assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (B) polymer(polypeptide(L)) [298 aa] Interleukin-12 subunit p40 :IL12B_HUMAN
2 b E 1 (B) non-polymer(PO4) PHOSPHATE ION 268W(R) 293R (identity: 50.0 %/27.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d87_B_1 identity=27.8%
queryA        39:PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVD--VPPEEPQLSCF: 122
                :**  * ***    **      * *         *   * *  *        * * * *   *                      * *   *     * * :
3d87_B_1      20:PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCE: 110
SecStr          :T EEEEEE  S--S  SS- EEEE------SS      BSSEEEEEESSGGG EEEEEEETTEEEE  EEEEEEEETTEE   SEE TT SSSS S EEE:    
ExpBur          :eeeebebebee--eeeee-bebbb------eeeeeeeeeeeebebebeebeebbebbbeeeeeeebebbbbbbbeeeeeebeebbeebebeeeebbbebb:    

queryA       123:RKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ: 206
                : *       * *                *       *  *  *                 ** * *  *   * *    *  *  *  *         * :
3d87_B_1     111:AKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYEQYTS: 203
SecStr          :BSSTTTEEEEEEEES  SSEEEEEEEEE SSS  EEEE   EEEEEEE SSSEEE----EEEEEEEETT---  SSS   S EEEEEEEEETTEEEEEEE:    
ExpBur          :bebbebebbbbbbbebeeebebebebbbbeeeeeebeeeeeeeeeeeeeeeeebb----bbbbebebee---eeeeeebeeebebebbbbbeeebbebee:    

queryA       207:TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS: 304
                : *    *  **** *        * *   * *  *  *    *   * *                  *     **             ***       **:
3d87_B_1     204:SFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQXXXXXXXXDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS: 298
SecStr          :EE GGGTB     EEEE  B -SS S EEEEEE  TTS S TTTS EEEEEE  -------- EEEESSSEEEE ----  TTSEEEEEEEESSS     :    
ExpBur          :ebebeebbbbeebeebebeee-eeeeebbbebebbeebbeeeeebbbbbbbbbe--------eeeebeeeebebe----beeebebbbbbbbeeeebeeb:    
Contact         :                                                               b                        b           

queryA       305:EWS: 307
                :** :
3d87_B_1     299:EWA: 301
SecStr          :  E:    
ExpBur          :eeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123