Protein Model on 3d87_D_1_I_1 (TEMPLATE: 3d87 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1] [assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) D 1 (D) polymer(polypeptide(L)) [296 aa] Interleukin-12 subunit p40 :IL12B_HUMAN
2 b I 1 (D) non-polymer(K) POTASSIUM ION 106V(T) 107H(D) 109L 118Q(F) (identity: 25.0 %/27.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d87_D_1 identity=27.8%
queryA        39:PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVD--VPPEEPQLSCF: 122
                :**  * ***    **      * *         *   * *  *        * * * *   *                      * *   *     * * :
3d87_D_1      20:PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCE: 110
SecStr          :T B  EEE  S--S  SS-EEEEE------TT  S  EESSEEE  BSSGGG EEEEEEESS    EEEEEEEEEETTEE   SS     SSSS   EEE:    
ExpBur          :eeeebebebeb--eeeee-bebbb------eeeeeeeeeeeebebebeeeeebbebbbbeeeeeebebbbbbbbeeeeeebeebbeebeeeeeeebbebb:    
Contact         :                                                                                 bb b          b    

queryA       123:RKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ: 206
                : *       * *                *       *  *  *                 ** * *  *   * *    *  *  *  *         * :
3d87_D_1     111:AKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYEQYTS: 203
SecStr          :BSSSSSEEEEEEEE   SS  EEEEEEE SSS EEEEEEEEEE    BSSSSB E----EEEEEEEETT---  SSS   S EEEEEEE  TTB EEEEE:    
ExpBur          :bebbebebbbbbbbebeeebebbbebbbbeeeeeebebeeeeeebeeebeeeebb----bbbbebebee---eeeeeebeeebbbebbbbbebbbbebee:    

queryA       207:TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS: 304
                : *    *  **** *        * *   * *  *  *    *   * *                  *     **             ***       **:
3d87_D_1     204:SFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVXXXXXXXXXDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS: 298
SecStr          :EE HHHHB        EEEE -TT SEEEEE    TTS S TTTS EEE B  ---------  B  SSSEEEEE----  SSS  B  EEESSS     :    
ExpBur          :ebbbbebbbbeebeebeeeee-eeeeebebebebbeebbeeeeebbbbbbbee---------ebeebeeeebebe----beeeeebbbebbbeeeebeeb:    

queryA       305:EWS: 307
                :** :
3d87_D_1     299:EWA: 301
SecStr          :   :    
ExpBur          :eeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123