Protein Model on 3duh_B_1_D_1 (TEMPLATE: 3duh )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (B) polymer(polypeptide(L)) [294 aa] Interleukin-12 subunit beta :IL12B_HUMAN
2 b D 1 (D) polymer(polypeptide(L)) [137 aa] Interleukin-23 subunit alpha :IL23A_HUMAN 126P(Y) 180V(C) 182E(A) 183G(A) 184D(E) 186S 209Q(F) 211C(R) 247S 248F(Y) 249Y(F) 296E(D) 297E(R) 298F(Y) 299G(Y) 300Q(S) (identity: 12.5 %/27.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3duh_B_1 identity=27.0%
queryA        39:PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVD--VPPEEPQLSCF: 122
                :**  * ***    **      * *         *   * *  *        * * * *   *                      * *   *     * * :
3duh_B_1      22:PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCE: 112
SecStr          :  EEEEEE SS--S  SS-EEEE ------TT     EESSEEEEEESSGGG EEEEEEETTEEEEEEEEEEEEEETTEE   SS    SSSSS   EEE:    
ExpBur          :ebeebebebeb--eeeee-bebbe------eeeeeeeeeeeebebebeeeeebbebbbeeeeeeebebebbbbbbeeeeebeebbeebeeeeeebbbebe:    

queryA       123:RKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ: 206
                : *       * *                *       *  *  *                 ** * *  *   * *    *  *  *  *         * :
3duh_B_1     113:AKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAEXXXXXNKEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYENYTS: 205
SecStr          :BSSSSSEEEEEEEES  SSEEEEEEEEE SSS EEEEE   EEEE -----   E----EEEEEEEETT---  TTS   S EEEEEEEEETTEEEEEEE:    
ExpBur          :bebbebebebbbbbebeeebebebebbbbeeeeeebebeebeeeee-----eeeb----ebebebebee---eeeeeebeeebbbebbbbbeebbbebeb:    
Contact         :   b                                                                     b bbb b                    

queryA       207:TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS: 304
                : *    *  **** *              * *  *  *    *   * *                  *     **             ***       **:
3duh_B_1     206:SFFIRDIIKPDPPKNLQLKPLXXXXQ-VEVSWEYPDTWSTPHSYFSLTFCVQVQGKXXXXKKDRVFTDKTSATVI----CRKNASISVRAQDRYYSSSWS: 300
SecStr          :EE HHHHB     EEEEEEE ---- -EEEEEE  TTS S TTTS EEEEEEEE  ----  EEEEESSSEEEE ----  TT EEEEEEEESSS     :    
ExpBur          :ebebbebbbbeebeebeeeee----e-bebebebbeebbeeeeebbbbbbbbbeee----eeeeeebeeeebebe----beeebebbbbbbbeeeebeeb:    
Contact         :  b b                                   b bbb                                              bbbbb    

queryA       305:EWS: 307
                :** :
3duh_B_1     301:EWA: 303
SecStr          :  E:    
ExpBur          :eeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123