Protein Model on 3ew3_B_1_C_1 (TEMPLATE: 3ew3 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) B 1 (B) polymer(polypeptide(L)) [203 aa] Prolactin receptor :PRLR_RAT
2 b C 1 (C) polymer(polypeptide(L)) [181 aa] Prolactin receptor :PRLR_RAT 269M(E) 270V(I) 271K(H) 278V(K) 279I(V) 280H(F) 281D 282A(L) 283W(Y) 288H(Y) (identity: 10.0 %/25.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3ew3_B_1 identity=25.4%
queryA       113:PPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDS-SFYIVSMCVASSVGSKFSKTQTFQGC: 211
                :**  *     *        * * *     * *   *   *      *     *     *   **            **         **  *        :
3ew3_B_1       4:PPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSK----EGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVT:  99
SecStr          :     EEEEEEBSSSS EEEEEE    TTS EEEEEEEE ----SS    EE SBSSTT TTEEEE TTT  TT EEEEEEEEEESS  B    EEEEGG:    
ExpBur          :ebeebebeebbbebbbbbbbebeeeeeeebebebebebbb----eeeeeeeebeeeeeeeeebbbbeeeebebeeebebebebebeeeeeebeebebbbb:    

queryA       212:GILQPDPPANIT--VTAVARNPRWLSVTWQDP--HSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHC--VIHDAWSGLRHVVQLRAQEEFGQGEWSE: 305
                : *  * ** * *  *         * * *  *              * *   *       *      *       *   *    ** *       * ** :
3ew3_B_1     100:YIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAE---EWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPD--HGYWSR: 194
SecStr          :G B     EEEEEEEEE SSS EEEEEEEE  TT   TTSSS B  EEEEEESS S---  EEEE TT SEEEE    TT  EEEEEE  BS--SS    :    
ExpBur          :ebbebeebeebebeeeeeeeeeebbebebebbeebeeeeeebebbbbbbbbeeeee---eeeeeebbeeeeeebeeeeeeeebbbbbebebe--eeeebe:    
Contact         :                                                             bbb       bbbbbbb    b                 

queryA       306:WSPEA: 310
                :** * :
3ew3_B_1     195:WSQES: 199
SecStr          :    E:    
ExpBur          :ebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123