Protein Model on 3hmx_A_1_E_1 (TEMPLATE: 3hmx )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 1 (A) polymer(polypeptide(L)) [295 aa] Interleukin-12 subunit beta :IL12B_HUMAN
2 b E 1 (C) branched(oligosaccharide) alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 194V(D) 201K(Y) 203S(N) (identity: 0.0 %/27.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3hmx_A_1 identity=27.8%
queryA        39:PGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAG--------------TVHLLVD--VPPEEPQLSCF: 122
                :**  * ***    **      * *         *   * *  *        * * * *   *                      * *   *     * * :
3hmx_A_1      20:PGEMVVLTCDT--PEEDG-ITWTL------DQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCE: 110
SecStr          :  EEEEEE S --S  SS- EEEE------TT      BSSEEEEEE SGGG EEEEEESSSSEEEEEEEEEEEESSSSB   SB    SSSSS  EEEE:    
ExpBur          :eeeebebebeb--eeeee-bebbb------eeeeeeeeeeeebebebbeeeebbebbbbeeeeeebebebbbbbeeeeeebeebbeebeeeeeebbbebe:    
Contact         :                                                                        b      b                    

queryA       123:RKSPLSNVVCEW----------------GPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQ: 206
                : *       * *                *       *  *  *                 ** * *  *   * *    *  *  *  *         * :
3hmx_A_1     111:AKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEY----EYSVECQEDS---ACPAAEESLPIEVMVDAVHKLKYENYTS: 203
SecStr          :BSSSSSEEEEEEEES  SSEEEEEEEEESSS SSS EE   EEEE    SSS  E----EEEEEEE   ---SS  SS  S EEEEEEEEETTEEEEEEE:    
ExpBur          :bebeebebebbbbbebeeeeebebebebeeeeeeebeeeeeeeebeeeeeeebbe----bbebebebee---eeeeeebeeebebebbbbbeebbbebee:    
Contact         :                                                                                       b      b b   

queryA       207:TFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNS--SFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWS: 304
                : *    *  **** *        * *   * *  *  *    *   * *                  *     **             ***       **:
3hmx_A_1     204:SFFIRDIIKPDPPKNLQLKPL-KNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQXXXXXXXKDRVFTDKTSATVI----CRXXXSISVRAQDRYYSSSWS: 298
SecStr          :EE GGGSB             -SS    EEE    SSS S TTTT EEEEE   -------   EEESSSEEE  ----  --- B EEEEESSS     :    
ExpBur          :ebebeebbebeebeebeeeee-eeeeebbbbbebbeebbeeeeeebbbbbbeee-------eeeeebeeeeeeee----ee---ebbbebbbeeeebeeb:    

queryA       305:EWS: 307
                :** :
3hmx_A_1     299:EWA: 301
SecStr          :   :    
ExpBur          :eeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123