Protein Model on 3l5h_A_1_C_1 (TEMPLATE: 3l5h )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6RA_HUMAN) A 1 (A) polymer(polypeptide(L)) [585 aa] Interleukin-6 receptor subunit beta :IL6RB_HUMAN
2 b C 1 (C) branched(oligosaccharide) beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 141S(N) (identity: 0.0 %/28.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3l5h_A_1 identity=28.6%
queryA       106:VHLLVDVPPEEPQ-LSCFRKSPLSNVVCEW-GPRST---PSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCV----AS: 196
                :       *** *  ***          *** * * *      * *      **    *                **        *  * *   *      :
3l5h_A_1      95:ITIISXLPPEKPKNLSCIVNEG-KKMRCEWDGGRETHLETNFTLKSEWATHKFADCKA----------KRDTPTSCTVDY----STVYFVNIEVWVEAEN: 179
SecStr          :     -      EEEEEEEETT-S EEEEEE  S  SS EEEEE  B SSSB   EE ----------BTTBSS  B  S----   SSS EEE EEEEE:    
ExpBur          :bebeb-eeeeebeebebbbebe-eebebebeeeeebebeeebbbbbbeeeeebeebeb----------eeeeeebbebeb----ebeeeeebebbbebeb:    
Contact         :                                        b                                                           

queryA       197:SVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDL---QHHCVIHDAWSGLRHVVQLR: 293
                :  *   *    *       * ** *  *         *  **  *     *   *     **     *       *           *       *   *:
3l5h_A_1     180:ALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR: 277
SecStr          :SS  B    EEE GGGSEE     S EEE TTT TT EEEE    GG--GGTS EEEEEEEEETT S  B   TTSS S  SEEEE S  SS  EEEEEE:    
ExpBur          :eeeeeebeeeebbbbeebbbeebeeeebeeeeeebeebebebebbeb--beebebbbbbbbeeeeeeeeeebeeeebeeeeeebebeebbeeeebbbbbb:    

queryA       294:AQEEFGQGEWSEWSPEAMGTPWTE--SRSP: 321
                :   * * * ** ** ** *       *  *:
3l5h_A_1     278:CMKEDGKGYWSDWSEEASGITYEDRPSKAP: 307
SecStr          :EEESSS S        B          S  :    
ExpBur          :bbbeeeeeeebeebeebeeebbeeebebeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123